PDE3B antibody (Middle Region)

Catalog No. ABIN634856

The Rabbit Polyclonal anti-PDE3B antibody has been validated for WB. It is suitable to detect PDE3B in samples from Human.

Quick Overview for PDE3B antibody (Middle Region) (ABIN634856)

Target: PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE3B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDE3B Antibody

Binding Specificity: Middle Region

Specificity: PDE3 B antibody was raised against the middle region of PDE3

Purification: Affinity purified

Immunogen: PDE3 B antibody was raised using the middle region of PDE3 corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDE3B Blocking Peptide, (ABIN5615273), is also available for use as a blocking control in assays to test for specificity of this PDE3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDE3B

Target: PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))

Alternative Name: PDE3B

Background: PDE3B belongs to the cyclic nucleotide phosphodiesterase family. It may play a role in fat metabolism.

Molecular Weight: 124 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, cAMP Metabolic Process